NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310130_0000686

Scaffold Ga0310130_0000686


Overview

Basic Information
Taxon OID3300034073 Open in IMG/M
Scaffold IDGa0310130_0000686 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23294
Total Scaffold Genes64 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (45.31%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.784Long. (o)-98.26Alt. (m)Depth (m)2896
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013631Metagenome / Metatranscriptome269Y
F036765Metagenome / Metatranscriptome169Y
F085684Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0310130_0000686_20967_21152F085684N/AMTQVIYGYREIERAYKILKDLVERESSLHLMDMTIQTQDLDNIQYEILPALEEIVFFDPT
Ga0310130_0000686_22413_22697F013631AGGAMLLSNLITLTSFKNQMILDVFHYTASRWDWQDGNVNQMWIQEIEESPDCYSYVAVAYNPRKNVSMVMSNPRGYFDTLNWVRSFCASFCILPEHC
Ga0310130_0000686_590_916F036765GAGGMTIQATELLKLLTKVEKLGLSVKVREDKDGDYVIRIFELFSPENFDEKVVITQKGEMTWDKGTYSFECMMSILDKMLEEKRQDEIKAQKRQELIARLTDEEKELLDLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.