| Basic Information | |
|---|---|
| Taxon OID | 3300034072 Open in IMG/M |
| Scaffold ID | Ga0310127_173075 Open in IMG/M |
| Source Dataset Name | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 829 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oklahoma | |||||||
| Coordinates | Lat. (o) | 35.784 | Long. (o) | -98.26 | Alt. (m) | Depth (m) | 2896 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015582 | Metagenome / Metatranscriptome | 253 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310127_173075_97_393 | F015582 | N/A | MNTNINPELESEQTEDAKYLEELNHYVSTLSAPSAESVALYRSKLSMLEDIHAEIRTKYPDFMPDYDAAKDEHITADPKYLDSTYSFSSRDLRNSSNS |
| ⦗Top⦘ |