Scaffold Ga0310127_010061

Overview

Basic Information

• Taxon OID: 3300034072
• Scaffold ID: Ga0310127_010061
• Source Dataset Name: Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6906
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (86.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Oklahoma
• Coordinates
  • Lat. (^o): 35.784
  • Long. (^o): -98.26
  • Depth (m): 2896

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025941	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310127_010061_840_1394	F025941	AGGAGG	MALPDYSGTVQGTAIVWGQSGATGATKELSFNNLANGSAQQGESADLALSTGGILLLPEFCWVYLSVETGTAPTAGLTVEAYLVSSYNNTLWPAKVTGSNGSYTLGTSDANLRQAGTPVVALKATADADTVITQDPSVWYPRGRYVSPIVDNNLGQAIRNETTPADNGSRLIVVPVYPAFVDSL