NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335028_0001322

Scaffold Ga0335028_0001322


Overview

Basic Information
Taxon OID3300034071 Open in IMG/M
Scaffold IDGa0335028_0001322 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17897
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (81.25%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000376Metagenome / Metatranscriptome1216Y
F005000Metagenome / Metatranscriptome415Y
F013888Metagenome / Metatranscriptome267Y
F068743Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0335028_0001322_12424_13083F013888AGGAMSTIGVLPASGKAARIGGIPKFCLPISDERSLLQWHVEQMLEVCDEVRVSTRAEWVPIIQNMDMNIKLIVREPSTMSDAVKFMIGDYNDTVLVGMPDTYIHACQKNIYKEMMSSPGDLVLGTWDCSEDLKGRVGQVLLSGDKVLSSMDKTFSCEYPQMWGTMLFRKNLIRYIDPSLEHPGKQIQEWLDMNLDVRAVRPGGKYMDIGTLKGLKQLYKEME
Ga0335028_0001322_1334_1624F005000GAGMTHKKINRFQIDAAFRSDSDIIRVKEQYEKLLTEDMRSRGYAKVLDIDPAFALDFDGEGWKFLMTIHGVYVGKRKAWRLEGISQGKLIPRNIPQRT
Ga0335028_0001322_16090_16338F000376GGAMSIYQEKAKECKCCGKHVPLPTVLKEYNEVMLCPTTFANVIEYKRLWKSLGSRPSGNIRKHFSDYVQQIVESTIDKNEDGTL
Ga0335028_0001322_16667_16849F068743AGGAGMPWQIKQNAAGCSGYAVIKEDTGELVGCHSGRTAAEAQMRALYASESDSKKMDQDKKRIF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.