NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335019_0009559

Scaffold Ga0335019_0009559


Overview

Basic Information
Taxon OID3300034066 Open in IMG/M
Scaffold IDGa0335019_0009559 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6625
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (35.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013514Metagenome / Metatranscriptome270Y
F047649Metagenome / Metatranscriptome149N
F072267Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0335019_0009559_1178_1363F047649N/AMRYYESRTYEHQCDFDAKNRAQKASQDYYKKWINLRKEVRNLVREQNLTITPEFAKLIGL
Ga0335019_0009559_4092_4244F013514GAGMKLEELQKFLTDNNITLEEYMRANMITDEDRKYFDKIWMDVIYKNLGEDT
Ga0335019_0009559_5994_6527F072267N/AMIEPIGYKLNPNKLKGAPQSILPYVVGAFYYTEDFEYFDVIKPYLDIPEPPKSLEEIQKELDEKIDKRIERVKEQFNKLGYTQEYQYQVKFNRIFENFEYARKNGRPREKFTLVMSNDSLSVNTYISSNFVIKEGGEEVGYYTFGSGYLRYCMNKKPNFIVRFCMNKLLGFKWISTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.