Scaffold Ga0334827_041207

Overview

Basic Information

• Taxon OID: 3300034065
• Scaffold ID: Ga0334827_041207
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1755
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp. UWO310 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0475
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022332	Metagenome / Metatranscriptome	214	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334827_041207_1646_1753	F022332	GGAG	MTGSKHNPEGNSSSNGEPAPGPYWRRMHRDRRFWIG