Scaffold Ga0334951_010287

Overview

Basic Information

• Taxon OID: 3300034029
• Scaffold ID: Ga0334951_010287
• Source Dataset Name: Biocrust microbial communities from Mojave Desert, California, United States - 47SNC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2580
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.7856
  • Long. (^o): -115.66

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001042	Metagenome / Metatranscriptome	794	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334951_010287_1537_1923	F001042	AGGCGG	MTTSHLIGGNFASDVPKDFEVDADDKIVIDKLLVNKLTELLINSIYSVHVSRRSEIFLTSLDMHLADFSISNKNDIVCREFTEKSSLLLESYQKDVPKSLGKAESCLGEAIDLINLIVSASEAEANNG