| Basic Information | |
|---|---|
| Taxon OID | 3300034029 Open in IMG/M |
| Scaffold ID | Ga0334951_001479 Open in IMG/M |
| Source Dataset Name | Biocrust microbial communities from Mojave Desert, California, United States - 47SNC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7849 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (90.91%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.7856 | Long. (o) | -115.66 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062306 | Metagenome | 130 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334951_001479_6299_6619 | F062306 | AGGCGG | MFTQKTLQDLILHHSLEHQGCSVVVLLQALNQVTERLDNIEALLEKRQKVETYQMKEVKRAMLSKIAGQLSHLEKTHFSTINDLTAEVKAVKQALENAKSKFIGFE |
| ⦗Top⦘ |