NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334949_016060

Scaffold Ga0334949_016060


Overview

Basic Information
Taxon OID3300034027 Open in IMG/M
Scaffold IDGa0334949_016060 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 45SNC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2286
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008145Metagenome / Metatranscriptome338Y
F092677Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0334949_016060_1_801F008145GGAGGMAVRGEEVASSIDAQVRESIEKMVAEIRSSVEDVRILVDQQLKAALQSVQADVNSITFLPQIRKSITEMEEAFDADRPAPAPTVSGAIRVKAAVQAIERGRSQVDVLNSLLEQCLEFGSRAALLILRGETFSGWKGVGFSAHGGNDEMIKRFNATPGLIPELDSVLRSEQVVAWDGANLATRLGVSRSDRAVLVPMVIKDKVAAAVYVDAVGDAVSKLDQDAIELLVFTTGLLVDTLAIRKKIPSPSLSDGSATAASPAAPATATMT
Ga0334949_016060_923_1543F092677GAGMRVIPLFFAGLALLGAACSAGDPPPDQQAEWRDVLRHKPAASAPDALPGHKQVYADSVRAFVVRHPEHNRAQQVWQRLQLEFADDLAGAGRYQDAIRFYRAVLTRHPESDHARRGLALAADRLAVTREKLLELHKGMSHRQVANILGKPMPGWSVKQRRAGTTFEAWYYRTRGGEVAAVYFRDGEVLAAEERSSARLARISDSEPH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.