Scaffold Ga0334940_000598

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334940_000598

Scaffold Ga0334940_000598

Overview

Basic Information
Taxon OID	3300034025 Open in IMG/M
Scaffold ID	Ga0334940_000598 Open in IMG/M
Source Dataset Name	Biocrust microbial communities from Mojave Desert, California, United States - 36SMC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10338
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (36.36%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.3778	Long. (^o)	-117.6098	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033948	Metagenome / Metatranscriptome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334940_000598_5447_5704	F033948	N/A	MRRKKMPDSNQTKSSLGERNEDPELKPDATPNPIEDVNPANDERAINVGESGQFAPGGRYNELGATKPRRIDLDEQVDSALSKEE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.