| Basic Information | |
|---|---|
| Taxon OID | 3300034024 Open in IMG/M |
| Scaffold ID | Ga0334927_000783 Open in IMG/M |
| Source Dataset Name | Biocrust microbial communities from Mojave Desert, California, United States - 23HNC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 13939 |
| Total Scaffold Genes | 17 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (58.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.3778 | Long. (o) | -117.6098 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066473 | Metagenome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334927_000783_5579_6664 | F066473 | GAG | MNYYFRLIFTSLKVGVAFNLFTLFLIAFYTLLIEYYFRPSQPLSNPRIEFGTAVSGGRIFSTADPKNYSFRPAWAKIESQFDLFISEFQLRADWKQASPRLEKWCKTRNCCAHRIGFSDRRIADFKCFTLDDWYLSNRDLLGSQYDSPIALNLDAFLFKLPRGSRVIVNEPYVLFANRQSFKDFTAWFLNLAARHPGLTFEVGLQVHLQWIDVYWRDYHGWLIPALGDFGRRHRVRWGITEFSIYDRVWKSRIIYGGATPPRTIFIDRFEQLIPDRFRRAIVAHQAYIFHRDALRTGALYFVEWGNFPSTWFLYELDFAYKSTFELYDWEGNPQLMYWAIARALNVDTVNTVDSVRQRKT |
| ⦗Top⦘ |