NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335021_0000238

Scaffold Ga0335021_0000238


Overview

Basic Information
Taxon OID3300034023 Open in IMG/M
Scaffold IDGa0335021_0000238 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)39218
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (26.32%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058094Metagenome / Metatranscriptome135Y
F082584Metagenome / Metatranscriptome113Y
F105025Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0335021_0000238_18665_18847F105025GAGMDTHQATASFTGLLATATGLTVSMLPELEAWLRIASLLIGCAVGLASLYAILKNKKHPHE
Ga0335021_0000238_21144_21512F082584N/AMATVLKLLRTTVPGRVPTAAQVAQGSLALNLADRRLFSKDHNNEVFRIARPRDPSDYQLLHAADGNHLYLGRLAWEDYPATGPAEDATAWTIYKISTNSAGDVVAETSAQGAWSSKLSLSYS
Ga0335021_0000238_22451_22723F058094N/AMSQVSFDPLTGNMISTTAQVAQLDSSGQISGTMIPDDFDDVQRFPTLADFPQVGVVARIYFSADNNVPHRWDPDTLSYLPIVADSDGGEF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.