NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335002_0164318

Scaffold Ga0335002_0164318


Overview

Basic Information
Taxon OID3300034020 Open in IMG/M
Scaffold IDGa0335002_0164318 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1421
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023037Metagenome / Metatranscriptome211N
F023279Metagenome / Metatranscriptome210N
F035195Metagenome / Metatranscriptome172N

Sequences

Protein IDFamilyRBSSequence
Ga0335002_0164318_1199_1420F023037N/ASQYNPSRLTTPAAAKLELISEIQASLNAIDSEESFGYNIQKVMRLYQAIERLKQIEPFWLFEVRVISAAGTLV
Ga0335002_0164318_280_783F023279AGGALFRFHVLTNRKDLKEKVTTEKMADSSKENTEAIVDTIKSELAIGFKNCIDKIDTEKKVVDRYNWEIYVKMNKILHNSRRLDPQWAIEGDIGNSWSLRSILERDFKSKILNIDLSEIDSIDLEGYEELHQSLKDLRTSNPGWSTNKTRRSSPILLTPTQIGLQEENTS
Ga0335002_0164318_802_1014F035195N/AMEYRTLKTEAEVVELVQSSLNNVETEKSFEDNYEVMLKLFCAIKRLKSIRPKGTFRAVGVSFKQVSTPQK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.