NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335002_0001442

Scaffold Ga0335002_0001442


Overview

Basic Information
Taxon OID3300034020 Open in IMG/M
Scaffold IDGa0335002_0001442 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20803
Total Scaffold Genes58 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)40 (68.97%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063745Metagenome / Metatranscriptome129Y
F095369Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0335002_0001442_17700_17969F095369GGAGGMAHIIRDGEIVPIPIKLNQRVKIGRYYQPPQLNHIANDQLWIQDVYAFKQIPWYMIKNRFERYLLYATLYGAIVVMLTMIGRYWLGAPH
Ga0335002_0001442_18349_18657F063745AGGAMDQLIVNSINLATKPNLQPQTPIKLSPRFKALARECGFVFWQDEPHGPGSGNIDWSCDYTTEFEHYSRELVTWTCELMRQEIVRDYAFGAARRTYEHIVVQD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.