NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334991_0003736

Scaffold Ga0334991_0003736


Overview

Basic Information
Taxon OID3300034013 Open in IMG/M
Scaffold IDGa0334991_0003736 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11609
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (74.19%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039142Metagenome / Metatranscriptome164Y
F092056Metagenome / Metatranscriptome107Y
F093292Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0334991_0003736_5243_5476F093292AGGAMPRKKIAAANTESPEVAQDVVDTMPTYYEYTTPDGTHVLLDRYEWTRGLGITDKAVKKAQAARHREVAKGFATVEEA
Ga0334991_0003736_5859_6131F039142AGGMMMKEGTDMKTFTTPQLVEQLYANLRVLAPQDAVNAYIAGYLSHCLADIATKGVDELTAIVDFTNQQVEVLEYNRRAYDRREKFENGEYA
Ga0334991_0003736_6162_6389F092056AGGMNFSVNDIEQVVLDGIAKAPDAFDYIYECISGTHGVKLSRYVNELYADVAIDHRLHPDDDFEEIINFMLDDLIGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.