NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334986_0004757

Scaffold Ga0334986_0004757


Overview

Basic Information
Taxon OID3300034012 Open in IMG/M
Scaffold IDGa0334986_0004757 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10439
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032199Metagenome / Metatranscriptome180Y
F036146Metagenome / Metatranscriptome170Y
F059774Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0334986_0004757_4526_4741F032199AGCAGGMREFCTNPKDCMALAYEREAEHEMDPRGLDAAYAEIVDSFHKEMEDFITKYCPKKLNEFDDLLEKAFWQYH
Ga0334986_0004757_6725_6895F036146GAGGMASTCRTYLITTYEGKKIALGAISAKQAEHFMLAMRPDIRIALIEEIPPLPEDPQL
Ga0334986_0004757_7915_8088F059774AGGAGMAFFTDGDYDNDPDLDWERPQRLNRQLSLQQLESRLELWKQKHEDMCLKLYRAATGI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.