NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334944_094389

Scaffold Ga0334944_094389


Overview

Basic Information
Taxon OID3300034009 Open in IMG/M
Scaffold IDGa0334944_094389 Open in IMG/M
Source Dataset NameSub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)565
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009290Metagenome / Metatranscriptome320Y

Sequences

Protein IDFamilyRBSSequence
Ga0334944_094389_3_515F009290GAGGMCGRNIAASAHKRPRRYTVEATAKNIDKTARTAREMAEAQRDSFEALAENFAGAQRRSMGLAEGGLEFVRLQEDNARAAQEFFARGVRLLQLQGRNAEFVQGWTGDAVEVVREQAEHNARTAEAFARAASRQQESFRTLARGWVGAYTDFFSPLAYARQATRAFQQATQQG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.