NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334979_0009552

Scaffold Ga0334979_0009552


Overview

Basic Information
Taxon OID3300033996 Open in IMG/M
Scaffold IDGa0334979_0009552 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6710
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (72.73%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000403Metagenome / Metatranscriptome1177Y
F005697Metagenome / Metatranscriptome392Y
F021065Metagenome / Metatranscriptome220Y
F025683Metagenome / Metatranscriptome200Y

Sequences

Protein IDFamilyRBSSequence
Ga0334979_0009552_3898_4392F021065N/AMKMTLTREEEFTCHQAALHLASKNTDYWQTREGGYSMDKPLHDLIAQDAQSIGSEWVVAKYLGVEFDPFEQKGKVKADVGSHFEVRWTKYVAGHLVVHEYDRPNDVAILVTGESPNYFIAGWIPIAMAKRPKYRHTKQPNWWVTQINLQPIENLRRSNYGHSSV
Ga0334979_0009552_4389_4583F000403GGAMSDFIEIIYPQTMTAKLMENGEVIAEYKVEQCDKCSMLTKFDAFGYQKGYDRGEKIIWFCAGCR
Ga0334979_0009552_4580_5236F005697AGGCGGMGFLDNYEASRERLERWNRTFPLGRIETRIVEFSAEKGYVLIEAKAFRNDTDLHPAGIDFAYGYQGAYQPNMRRWFVEDSTTSAIMRVQQLVMGGAERSTREVMEQVEKTPAKIANTDSTDYWTTKFGDVPSYKTAAEAEQSGIPSFGSSMDEIAKQLGGELVQEAPQCSHGHMIWKQSHEGAPKSWGGYFCTERTKATQCTPRWYVLRSTGKWEPQV
Ga0334979_0009552_5236_5409F025683GGAGMVLDLLDPETLGRLVLAIILMVISAAAGYAKGFKEGKREGMARRKAMVRHMSNKAVN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.