NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335003_0055199

Scaffold Ga0335003_0055199


Overview

Basic Information
Taxon OID3300033995 Open in IMG/M
Scaffold IDGa0335003_0055199 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2126
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054031Metagenome / Metatranscriptome140Y
F071229Metagenome / Metatranscriptome122Y
F093858Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0335003_0055199_1208_1372F071229GGAGGMSDTTAIVSACLIMMSLYTTFHLGIECERERARQARRKKFDQDNNDSANHDDFD
Ga0335003_0055199_883_1002F093858GGAGGMIDLHDPAAVCRSLGYFLDFLTLTVPVLSLALIARRIAR
Ga0335003_0055199_999_1211F054031GGAGGMSAADWDAILANRDKAEALPECDWTTETPETEAAVKASGSTFGIPLRETSRRLERQRNGLYQLLNRRATQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.