| Basic Information | |
|---|---|
| Taxon OID | 3300033991 Open in IMG/M |
| Scaffold ID | Ga0334965_0000011 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 219659 |
| Total Scaffold Genes | 257 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 163 (63.42%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Croatia: Zadar | |||||||
| Coordinates | Lat. (o) | 43.9359 | Long. (o) | 15.5428 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094748 | Metagenome | 105 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334965_0000011_94271_94516 | F094748 | GAGG | MEGKEGHEHLSRLRKRAIDQFAIGLVILLWGSLLMMKQAGIIDKTVSTLPFLLTAFGILLVIGGIYKLSTARRSQEKATGR |
| ⦗Top⦘ |