Scaffold Ga0334977_0164658

Overview

Basic Information

• Taxon OID: 3300033978
• Scaffold ID: Ga0334977_0164658
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1139
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.0995
  • Long. (^o): -89.4045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054683	Metagenome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0334977_0164658_770_1033	F054683	N/A	MNKTEKRKELNKLVFEMVTDLGYKIIDDGEGGRITFIKPGQKNYDNSIDYHLSRFDICVLNYASNDIKEDAKTIKWFIETQRKSLDI