Scaffold Ga0314861_0515894

Overview

Basic Information

• Taxon OID: 3300033977
• Scaffold ID: Ga0314861_0515894
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 511
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Peru: Loreto
• Coordinates
  • Lat. (^o): -4.0712
  • Long. (^o): -73.2029
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018247	Metagenome / Metatranscriptome	236	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314861_0515894_111_500	F018247	N/A	LSRVNGQHIFKTMLNGDPVLLYAGPADVNAPYRSLTDADYIRIRDLANSNGWSHEKTDGVSTQELTIEGRAALMTRFRYQRDGKTWWVGERTLIEDDGMQFLLGCTAPEQRFADAEALCTTLVNSLRLP