NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314861_0000362

Scaffold Ga0314861_0000362


Overview

Basic Information
Taxon OID3300033977 Open in IMG/M
Scaffold IDGa0314861_0000362 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)76201
Total Scaffold Genes66 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)46 (69.70%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NamePeru: Loreto
CoordinatesLat. (o)-4.0712Long. (o)-73.2029Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020642Metagenome / Metatranscriptome222Y
F039913Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0314861_0000362_2447_2842F039913AGGMAGLFLALTLLGLPSRTALQAQESRKSKVPVIDKIGSGGPSQQAFSGIFKSVDLRAEILNVDNINGKSTEVFPVKKKVHVVTADGDKLGLSNLKPGTNILVYYDQKGDRRTVTRIVVLAGAPEKKKPSPPS
Ga0314861_0000362_43104_43586F020642GGAGGVNNHLSEDQIAEWLLGAKDEMALRHLEACHECSREAEQLRSAIAGFRDSIHAAAQRDQSFWRNPQHAIGERISGWYSMYWAWAVAMVLVLIAALFLMRAPRAPQNSASEDADNFLLQEVQGDLAREVPEALAPAALIAQERDEILSHQVIGQSQNLQKRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.