Scaffold Ga0326768_032697

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326768_032697

Scaffold Ga0326768_032697

Overview

Basic Information
Taxon OID	3300033893 Open in IMG/M
Scaffold ID	Ga0326768_032697 Open in IMG/M
Source Dataset Name	Hot spring sediment microbial communities from Norris-Mammoth Corridor, Yellowstone National Park, WY, United States - NMC.RSW_S
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	808
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.7535	Long. (^o)	-110.7249	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043237	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326768_032697_224_808	F043237	AGGAGG	MDLEKTAKYIAQLSRHGYKYAILGELLRYDKELVKKLEYDGFVFYLCRLPSKKDIVSYCLPRTDKPFKVYCLSSKPLEFPNAPLKLWYDEKSQRLKLIAQKSFISDCLNAIERASSLTYPSPKLYTGHINRILRQLFEILAWTYNDRERVRAIRRKVKHWVVEALKTQYGLKPKNAMTDYKRYVLKFSDVLRKKA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.