| Basic Information | |
|---|---|
| Taxon OID | 3300033892 Open in IMG/M |
| Scaffold ID | Ga0326767_003823 Open in IMG/M |
| Source Dataset Name | Hot spring water microbial communities from Norris-Mammoth Corridor, Yellowstone National Park, WY, United States - NMC.RSE_P |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2635 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring Water → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.7535 | Long. (o) | -110.7249 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052705 | Metagenome | 142 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326767_003823_191_421 | F052705 | N/A | MIAVGVALTVAGVAGGLAGMHLMLVLIPIGLATTVLGLLDYTWLLRGSEPTPLMLLAILLGEAAATLAIIIIEGWV |
| ⦗Top⦘ |