NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326767_002428

Scaffold Ga0326767_002428


Overview

Basic Information
Taxon OID3300033892 Open in IMG/M
Scaffold IDGa0326767_002428 Open in IMG/M
Source Dataset NameHot spring water microbial communities from Norris-Mammoth Corridor, Yellowstone National Park, WY, United States - NMC.RSE_P
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3553
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Sulfolobales → Sulfolobaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring Water → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.7535Long. (o)-110.7249Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089165Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0326767_002428_570_908F089165AGGAGGMTVVKKGEEKREITYTREQFEKKYENLYTLFNAIEFAHNKVQLTATKTVEEKDIFDVINQVLEMQRSLSSEATPNDVLNAFKIFAELLKTVTDPKTIEFVKMITTKLAGEKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.