Basic Information | |
---|---|
Taxon OID | 3300033887 Open in IMG/M |
Scaffold ID | Ga0334790_042903 Open in IMG/M |
Source Dataset Name | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1750 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Norrbotten County, Stordalen Mire | |||||||
Coordinates | Lat. (o) | 68.3534 | Long. (o) | 19.0473 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027298 | Metagenome / Metatranscriptome | 195 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0334790_042903_1_171 | F027298 | N/A | INKRNISSSEISTQEDAMQKACNLMQQGHVVSHVAGPNGERIDIVDIRQWCSAHER |
⦗Top⦘ |