NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334790_028495

Scaffold Ga0334790_028495


Overview

Basic Information
Taxon OID3300033887 Open in IMG/M
Scaffold IDGa0334790_028495 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2356
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3534Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085353Metagenome / Metatranscriptome111Y
F096852Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0334790_028495_1292_1495F085353GGAGGMELTLTNAERELLLEILKQHHRELFREIARTDHRELKLVLKNKEVLLDSLVNKLELMPLGELMAQVT
Ga0334790_028495_2046_2354F096852N/AAEIRVIPLEQAERNRAALESLRARVAQAERENESLWLVDSNVRQQLSLQAELMRDLLQLAEQQQSNHGKSPNALAVERRLNQLQGQTMCEACHSGIVARNQN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.