Scaffold Ga0334790_000297

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334790_000297

Scaffold Ga0334790_000297

Overview

Basic Information
Taxon OID	3300033887 Open in IMG/M
Scaffold ID	Ga0334790_000297 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	52099
Total Scaffold Genes	53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	31 (58.49%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Norrbotten County, Stordalen Mire
Coordinates	Lat. (^o)	68.3534	Long. (^o)	19.0473	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081272	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334790_000297_26819_27055	F081272	AGG	VDHDDSTFGGLSPLTAILIVLALATLGGLLYGAAGTRRNRDPEPAAGAPAPATPTKKRRPIGRRVAMWTLRRIVRQFT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.