Scaffold Ga0326764_010644

Overview

Basic Information

• Taxon OID: 3300033830
• Scaffold ID: Ga0326764_010644
• Source Dataset Name: Hot spring sediment microbial communities from Norris Geyser Basin, Yellowstone National Park, WY, United States - NOR.RB_S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1659
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified archaeal dsDNA viruses → Sulfolobales Virus YNP2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.7265
  • Long. (^o): -110.709

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052280	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326764_010644_1359_1658	F052280	AGGA	MAESQVLMIELKKYGFRFYLNNNPEKSWFINVNDTRPEYFVFVEETNREMKNVLDYKYEDFGVKNILELLIALILRPNEYFEQLTGEKTNIKEIHIFHF