Scaffold Ga0334816_102196

Overview

Basic Information

• Taxon OID: 3300033819
• Scaffold ID: Ga0334816_102196
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 526
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3533
  • Long. (^o): 19.0466
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100048	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334816_102196_108_326	F100048	GGGGG	MAAPRDALHHLIDGLPDAELGAALRFLKFLSQEPADPPLAASIRRGITEADAGRTIICHSYDEMVEKVLGKE