Scaffold Ga0314867_000441

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0314867_000441

Scaffold Ga0314867_000441

Overview

Basic Information
Taxon OID	3300033808 Open in IMG/M
Scaffold ID	Ga0314867_000441 Open in IMG/M
Source Dataset Name	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8568
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location Name	Peru: Loreto
Coordinates	Lat. (^o)	-6.3272	Long. (^o)	-74.8136	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079856	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314867_000441_6193_7269	F079856	GGAGG	MTKPGLNCVVVAVVGFLFAFEFSSTAAAGSENVTFATWREPNEGAYTIDVPRGWQVAGGVRRQSPVDIRTALNVTSPDGVIRIFIGDYDLAPRREPDQLTQMAGMREGHVYQGVLLARYMTGVQVARSYPAWKLCRQAKITQSGALQHESQTLTAQVAQYGQSMATAASASVGEAIFQCPVGEGFVMATTLLTRPMSGRGVSGWFVYELSGFTTRDPKQAYFAKYVLSAMLASRKDNPEWDARVSQAAGQYAESMMQMNNAMTQSTIQHAKQQAAQGSAGGWNHPNTGDVPKVKHNAESERQRDIANRGTREVCDNLGTCKTVDNSWETVWRDHSGNVVPGSASGYPPDYSGQWTQMK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.