Scaffold Ga0314870_019306

Overview

Basic Information

• Taxon OID: 3300033760
• Scaffold ID: Ga0314870_019306
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 590
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. OR-1 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Peru: Loreto
• Coordinates
  • Lat. (^o): -4.5438
  • Long. (^o): -74.6258
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103513	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314870_019306_16_444	F103513	N/A	LTLFATYTIAEEFLTLITPEEAAQPDAPMIRTRGIKMTKAEGDGPQIKINSPNLEEPLRIPFVMDIAFEASSDKVIDFDTLSIKYIKVIPIDLTGKIKPYLNNNRLVVKDVKIPQGKHRLQLYIAYTSGEKTMVEIVLNTEK