| Basic Information | |
|---|---|
| Taxon OID | 3300033746 Open in IMG/M |
| Scaffold ID | Ga0373123_006 Open in IMG/M |
| Source Dataset Name | Fracking water microbial communities from gas well in Marcellus Shale, West Virginia, United States - MIP3H_02032016 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Ohio State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 275149 |
| Total Scaffold Genes | 466 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 27 (5.79%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: West Virginia | |||||||
| Coordinates | Lat. (o) | 39.6017 | Long. (o) | -79.9761 | Alt. (m) | Depth (m) | 2281 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040720 | Metagenome | 161 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0373123_006_85811_86026 | F040720 | N/A | MRIYQLKTAEEFYKSISGNFTTAELMQMYAEDVAKRFAAECVNETLGNKMEVSNSLHSKIESKYRSIIWDN |
| ⦗Top⦘ |