| Basic Information | |
|---|---|
| Taxon OID | 3300033742 Open in IMG/M |
| Scaffold ID | Ga0314858_035644 Open in IMG/M |
| Source Dataset Name | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1167 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Alaska | |||||||
| Coordinates | Lat. (o) | 71.2943 | Long. (o) | -156.7153 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058283 | Metagenome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0314858_035644_9_395 | F058283 | N/A | MSDDTLAIKTDEPKPTIFQGGVMTSEGLVCADGSVIPRATKPEPRKGLTEEDEITISKWVNDYHRDYPNVDVGLVKMFCTWAFRHPEACEEHVKEQKDKIMNMTNEERIEMVKRNGFDELEKDYDRMK |
| ⦗Top⦘ |