Scaffold Ga0314858_019285

Overview

Basic Information

• Taxon OID: 3300033742
• Scaffold ID: Ga0314858_019285
• Source Dataset Name: Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1483
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Alaska
• Coordinates
  • Lat. (^o): 71.2943
  • Long. (^o): -156.7153
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071663	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0314858_019285_1198_1383	F071663	AGGA	MNDLAEEIIAEIRRDIDMDNLMALQEVLSKLLENTDNKHILTRYLSEFPELREEYKDRKD