Scaffold Ga0326734_1015191

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326734_1015191

Scaffold Ga0326734_1015191

Overview

Basic Information
Taxon OID	3300033552 Open in IMG/M
Scaffold ID	Ga0326734_1015191 Open in IMG/M
Source Dataset Name	Glacier ice microbial communities from Ngari, Tibet, China - 15_GP2_131.5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2204
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	China: Ngari, Tibet
Coordinates	Lat. (^o)	35.2833	Long. (^o)	81.4833	Alt. (m)		Depth (m)	131
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009686	Metagenome / Metatranscriptome	314	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326734_10151915	F009686	N/A	MFEASFKRPTDYFKLSSDHQWAIDSRLGILDWSGEGLSEEDIARFKAHYTRKRNKNVS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.