| Basic Information | |
|---|---|
| Taxon OID | 3300033552 Open in IMG/M |
| Scaffold ID | Ga0326734_1000003 Open in IMG/M |
| Source Dataset Name | Glacier ice microbial communities from Ngari, Tibet, China - 15_GP2_131.5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 92043 |
| Total Scaffold Genes | 116 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (12.07%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Ngari, Tibet | |||||||
| Coordinates | Lat. (o) | 35.2833 | Long. (o) | 81.4833 | Alt. (m) | Depth (m) | 131 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048842 | Metagenome / Metatranscriptome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326734_100000371 | F048842 | N/A | MKKSITVILITFLLSAAALIGEVCCIYKMCTCNWEPIGKAEIFYTVGTFTGAGCIIGYINIEDK |
| ⦗Top⦘ |