Basic Information | |
---|---|
Taxon OID | 3300033551 Open in IMG/M |
Scaffold ID | Ga0247830_10916386 Open in IMG/M |
Source Dataset Name | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 698 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New York | |||||||
Coordinates | Lat. (o) | 42.673 | Long. (o) | -77.032 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096838 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247830_109163861 | F096838 | N/A | AMASPGMVWWGRADDTFTAMRAGSPVSMLLLAAGTGCGALGLLIFFTERGVANEIKGFVLLLIAGVLLVGGCVLWELRSIRRGLERRNPE |
⦗Top⦘ |