Scaffold Ga0316212_1069363

Overview

Basic Information

• Taxon OID: 3300033547
• Scaffold ID: Ga0316212_1069363
• Source Dataset Name: Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.9979
  • Long. (^o): 10.7895

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061124	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316212_10693632	F061124	N/A	ATSSEEADGDWVRAFEFPDRDPVAVSGAIDFPGGSVTALWTEARADTAVAVVRNRETGSYDAFRLAMACSQ