Scaffold Ga0316596_1223489

Overview

Basic Information

• Taxon OID: 3300033541
• Scaffold ID: Ga0316596_1223489
• Source Dataset Name: Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 527
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location

• Location Name: USA: Alabama
• Coordinates
  • Lat. (^o): 30.2619
  • Long. (^o): -88.2383
  • Depth (m): 0 to .07

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030933	Metagenome / Metatranscriptome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316596_12234892	F030933	GAG	MKDNSKSDQLNLQRAQAVKTEWIVGIIAILIFATFIGSAVIGH