Scaffold Ga0314761_1119775

Overview

Basic Information

• Taxon OID: 3300033526
• Scaffold ID: Ga0314761_1119775
• Source Dataset Name: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 583
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.3956
  • Long. (^o): -85.372

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026180	Metagenome / Metatranscriptome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314761_11197751	F026180	GGAGG	VHPIARHSAADCREIQKLAKRVSGRREQSSKDGSPPPRQRSGKEKASDSGTAAGEKELGYQSPARELKGVYHDDNSDSDSDDRRKKLYVMYGGSWELVFRRDVKTLHREVFSVKPGVPKAAPHHRWMNTTISFGPSDCPENMAGAGVLPLVTAPVISNVR