Scaffold Ga0316616_100885680

Overview

Basic Information

• Taxon OID: 3300033521
• Scaffold ID: Ga0316616_100885680
• Source Dataset Name: Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1099
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium pictum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 41.3776
  • Long. (^o): -82.5117
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050165	Metagenome / Metatranscriptome	145	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0316616_1008856803	F050165	N/A	RALCASTPALRCLAPLDAILAPALGLYWIRTLPASGGLVGAVLGVFCLWIGARRAYRALFEFEAYRWMTLRLAKLAIATWVVMAMVKLVWFIQGSV