| Basic Information | |
|---|---|
| Taxon OID | 3300033490 Open in IMG/M |
| Scaffold ID | Ga0326760_1062272 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial communities from Geyser Creek Basin, Yellowstone National Park, WY, United States - GCR.EP_S |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 673 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.6904 | Long. (o) | -110.7291 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092976 | Metagenome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326760_10622722 | F092976 | GGAGG | MTVQEILHWKQELRRVRQEFLQVWQQCPRCGAKWADIAWDAESDHEFLLVECRNHHLFRADEQFWLFDYDDTGVYAPSETAMTEVSAHAG |
| ⦗Top⦘ |