Scaffold Ga0316630_12110511

Overview

Basic Information

• Taxon OID: 3300033487
• Scaffold ID: Ga0316630_12110511
• Source Dataset Name: Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 519
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 41.3776
  • Long. (^o): -82.5117
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035352	Metagenome / Metatranscriptome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316630_121105111	F035352	N/A	EYAMLIEVIGEFEKQKTNRTARDKLGNPAETVLRNHLLRRNLNLSAVPNVTIQGSKIENDLLLLKLGVDPNQKSYTSNHVKMVIEVKSSGVGAKTLPNGKLLDPNKSLRTKFNALQATTNVRNYAVIVLSETLLPTGGPYKWRFKEEAIRKENCKVFTLVARELYPVGGLFI