| Basic Information | |
|---|---|
| Taxon OID | 3300033486 Open in IMG/M |
| Scaffold ID | Ga0316624_11926168 Open in IMG/M |
| Source Dataset Name | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 548 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio | |||||||
| Coordinates | Lat. (o) | 41.3776 | Long. (o) | -82.512 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011832 | Metagenome / Metatranscriptome | 286 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316624_119261681 | F011832 | AGGAGG | LNRHRRIQPTATVELETVALRLPSPLVRAVDQYAKYLGGSTDRTHVITQALEIALAQDADFQKTLTDRSTPSVDPVRATA |
| ⦗Top⦘ |