| Basic Information | |
|---|---|
| Taxon OID | 3300033485 Open in IMG/M |
| Scaffold ID | Ga0316626_10277634 Open in IMG/M |
| Source Dataset Name | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1354 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio | |||||||
| Coordinates | Lat. (o) | 41.3792 | Long. (o) | -82.512 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002104 | Metagenome / Metatranscriptome | 593 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316626_102776342 | F002104 | N/A | CLNTVGMTKKRTRPNPFSPQEVRLIEQLREHPEMLERVQSILEIARSEQGPLKTADEVEELLIQEVRRLGSATMHQWAVGAEERVSTELKSQDPTVRSRKKKR |
| ⦗Top⦘ |