| Basic Information | |
|---|---|
| Taxon OID | 3300033464 Open in IMG/M |
| Scaffold ID | Ga0315915_1062003 Open in IMG/M |
| Source Dataset Name | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1124 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.06 | Long. (o) | -118.44 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021933 | Metagenome | 216 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315915_10620031 | F021933 | GGA | VEADSNPFWIGAAGPLGRKVDAAFDLRLLQSQHQPQKDTSNEGLFDRGVLLIPYESILRSLCPLEKALEVRTSVERSESFALGRRFAVAKLNASLSPRARLRPRLLVTSRRLFRHPRSKSASAKIP |
| ⦗Top⦘ |