| Basic Information | |
|---|---|
| Taxon OID | 3300033434 Open in IMG/M |
| Scaffold ID | Ga0316613_10098890 Open in IMG/M |
| Source Dataset Name | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1775 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Soil Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio | |||||||
| Coordinates | Lat. (o) | 41.3777 | Long. (o) | -82.5117 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037788 | Metagenome / Metatranscriptome | 167 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316613_100988902 | F037788 | AGGGGG | MKQVKGLGGWIRSAIWLELIIPGYFFGKTFGTSDAKFRFLDQFMYPPLFINICGYFRDLPVGHYTGRFLGMLAGAVIGVLCALLIGVFYKWVLKDWAYSKAARIGSMAFILIALMTGFMSDMFNESIGMGLRLDEDVPEELVGKYLVQDYGSFAKGTMITEENAGLLAAYGKVRANNEASAYNWWIASLVFMYSWFILYFICAHRFFKRNLVPRQAYFKLQMINLVAIIIYLRMGFGIAPAEYHFIVTRFQYLFGGGV |
| ⦗Top⦘ |