| Basic Information | |
|---|---|
| Taxon OID | 3300033433 Open in IMG/M |
| Scaffold ID | Ga0326726_11355261 Open in IMG/M |
| Source Dataset Name | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 692 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York | |||||||
| Coordinates | Lat. (o) | 42.3286 | Long. (o) | -76.4792 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007147 | Metagenome / Metatranscriptome | 357 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326726_113552611 | F007147 | GAG | MVELAAMNDGVRRCLAGGLVVFLWIVPPQIHALAEDDPLQKAVNYLFTGSNNPQEVPEILDRKSCVVVVPDPKSKQFIRYYVGRFRIDTAFINKTYAGSETVYSLDVKGAEVIVEYLDVDKSTVLHGHKSAQISLPGDIDQTNKALALISSLCRNGKPKDQF |
| ⦗Top⦘ |